| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MBOAT7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MBOAT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MBOAT7. This antibody reacts with human. The MBOAT7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4 (NM_024298). Peptide sequence WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA. |
|---|
| Other Names | 1-acylglycerophosphatidylinositol O-acyltransferase, BB1LPLAT 7, Bladder and breast carcinoma-overexpressed gene 1 protein, EC 2.3.1.-, EC 2.3.1.n4, h-mboa-7, hMBOA-7, LENG4FLJ41296, leukocyte receptor cluster (LRC) member 4, Leukocyte receptor cluster member 4, LPIATO-acyltransferase domain-containing protein 7, LRC4, Lysophosphatidylinositol acyltransferase, lysophospholipid acyltransferase 7, Lyso-PI acyltransferase, malignant cell expression-enhanced gene/tumor progression-enhanced, MBOA7, membrane bound O-acyltransferase domain containing 7, Membrane-bound O-acyltransferase domain-containing protein 7, OACT7 |
|---|
| Gene, Accession # | MBOAT7, Gene ID: 79143, Accession: Q96N66, SwissProt: Q96N66 |
|---|
| Catalog # | NBP1-62511 |
|---|
| Price | |
|---|
| Order / More Info | MBOAT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|