| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MBOAT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MBOAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MBOAT1. This antibody reacts with human. The MBOAT1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. |
|---|
| Other Names | dJ434O11.1, EC 2.3.1.-, EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase, LPEAT1, LPLAT 1, LPSAT, lysophosphatidylethanolamine acyltransferase 1, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 1, Lyso-PS acyltransferase, membrane bound O-acyltransferase domain containing 1, Membrane-bound O-acyltransferase domain-containing protein 1, MGC44669, OACT1, O-acyltransferase (membrane bound) domain containing 1, O-acyltransferase domain-containing protein 1 |
|---|
| Gene, Accession # | MBOAT1, Gene ID: 154141, Accession: Q6ZNC8, SwissProt: Q6ZNC8 |
|---|
| Catalog # | NBP1-55258-20ul |
|---|
| Price | |
|---|
| Order / More Info | MBOAT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|