| Edit |   |
|---|
| Antigenic Specificity | Tfdp2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-Tfdp2 Antibody |
|---|
| Immunogen | The immunogen for Anti-Tfdp2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tfdp2. Synthetic peptide located within the following region: IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE |
|---|
| Other Names | DP2, transcription factor Dp-2 (E2F dimerization partner 2) |
|---|
| Gene, Accession # | Tfdp2, Accession: NM_001106847 |
|---|
| Catalog # | TA329626 |
|---|
| Price | |
|---|
| Order / More Info | Tfdp2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|