| Edit |   |
|---|
| Antigenic Specificity | RIIAD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-RIIAD1 Antibody |
|---|
| Immunogen | The immunogen for Anti-RIIAD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human RIIAD1. Synthetic peptide located within the following region: LLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREI |
|---|
| Other Names | C1orf230, NCRNA00166, regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 |
|---|
| Gene, Accession # | RIIAD1, Accession: NM_001144956 |
|---|
| Catalog # | TA332180 |
|---|
| Price | |
|---|
| Order / More Info | RIIAD1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|