| Edit |   |
|---|
| Antigenic Specificity | TMEM187 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM187 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM187. This antibody reacts with human. The TMEM187 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM187(transmembrane protein 187) The peptide sequence was selected from the middle region of TMEM187. Peptide sequence ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA. |
|---|
| Other Names | chromosome X open reading frame 12, FLJ95849, ITBA1DXS9878ECXorf12, Protein ITBA1, transmembrane protein 187 |
|---|
| Gene, Accession # | TMEM187, Gene ID: 8269, Accession: Q14656, SwissProt: Q14656 |
|---|
| Catalog # | NBP1-69553 |
|---|
| Price | |
|---|
| Order / More Info | TMEM187 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|