| Edit |   |
| Antigenic Specificity | MIR22HG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MIR22HG Antibody |
| Immunogen | The immunogen for Anti-MIR22HG Antibody is: synthetic peptide directed towards the C-terminal region of Human MIR22HG. Synthetic peptide located within the following region: SRVDDTFWASWRAFAQIGPARSGFRLETLAGLRSRRLKQPKAFCLRDVAP |
| Other Names | C17orf91, MIR22 host gene (non-protein coding) |
| Gene, Accession # | MIR22HG, Accession: NM_032895 |
| Catalog # | TA331691 |
| Price | |
| Order / More Info | MIR22HG Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |