| Edit |   |
|---|
| Antigenic Specificity | TMEM178 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM178 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM178. This antibody reacts with human. The TMEM178 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC33926 The peptide sequence was selected from the middle region of MGC33926. Peptide sequence RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF. |
|---|
| Other Names | MGC33926, transmembrane protein 178 |
|---|
| Gene, Accession # | TMEM178A, Gene ID: 130733, Accession: Q8NBL3, SwissProt: Q8NBL3 |
|---|
| Catalog # | NBP1-69634 |
|---|
| Price | |
|---|
| Order / More Info | TMEM178 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|