| Edit |   |
|---|
| Antigenic Specificity | TMEM168 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM168 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM168. This antibody reacts with human. The TMEM168 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM168(transmembrane protein 168) The peptide sequence was selected from the C terminal of TMEM168. Peptide sequence EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL. |
|---|
| Other Names | FLJ13576, transmembrane protein 168 |
|---|
| Gene, Accession # | TMEM168, Gene ID: 64418 |
|---|
| Catalog # | NBP1-70727-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM168 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|