| Edit |   |
| Antigenic Specificity | TMEM164 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM164 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM164. This antibody reacts with mouse. The TMEM164 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Tmem164 - N-terminal region. Peptide sequence QQVTQRPEEGKESLSKNLLLVALCLIFGVEVGFKFATKTVIYLLNPCHLV. |
| Other Names | transmembrane protein 164 |
| Gene, Accession # | TMEM164, Gene ID: 84187, Accession: NP_808260 |
| Catalog # | NBP1-98383-20ul |
| Price | |
| Order / More Info | TMEM164 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |