| Edit |   |
|---|
| Antigenic Specificity | ATP6AP1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog, horse, porcine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ATP6AP1L Antibody |
|---|
| Immunogen | The immunogen for Anti-ATP6AP1L Antibody: synthetic peptide directed towards the C terminal of human LOC92270. Synthetic peptide located within the following region: LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS |
|---|
| Other Names | ATPase, H+ transporting, lysosomal accessory protein 1-like |
|---|
| Gene, Accession # | VAS1L, Accession: NM_001017971 |
|---|
| Catalog # | TA336069 |
|---|
| Price | |
|---|
| Order / More Info | ATP6AP1L Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|