Edit |   |
Antigenic Specificity | ATP6AP1L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, dog, horse, porcine |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ATP6AP1L Antibody |
Immunogen | The immunogen for Anti-ATP6AP1L Antibody: synthetic peptide directed towards the C terminal of human LOC92270. Synthetic peptide located within the following region: LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS |
Other Names | ATPase, H+ transporting, lysosomal accessory protein 1-like |
Gene, Accession # | VAS1L, Accession: NM_001017971 |
Catalog # | TA336069 |
Price | |
Order / More Info | ATP6AP1L Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |