| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SETD8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SETD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SETD8. This antibody reacts with human. The SETD8 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SETD8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK |
|---|
| Other Names | H4-K20-HMTase SETD8, H4K20-specific histone methyltransferase splice variant Set8b, Histone-lysine N-methyltransferase SETD8, KMT5A, KMT5A SET domain-containing protein 8, Lysine N-methyltransferase 5A, PR/SET domain containing protein 8, PR/SET domain-containing protein 07, PR/SET07, PRSET7, PR-Set7EC 2.1.1.43, SET domain containing (lysine methyltransferase) 8, SET07SET8H4-K20-specific histone methyltransferase, SET8 |
|---|
| Gene, Accession # | SETD8, Gene ID: 387893 |
|---|
| Catalog # | NBP2-55772 |
|---|
| Price | |
|---|
| Order / More Info | SETD8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|