| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SETD7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SETD7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SETD7. This antibody reacts with human. The SETD7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SETD7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS |
|---|
| Other Names | EC 2.1.1.43, H3-K4-HMTase SETD7, histone H3-lysine 4-specific methyltransferase, histone-lysine N-methyltransferase SETD7, KIAA1717SET domain-containing protein 7, KMT7FLJ21193, Lysine N-methyltransferase 7, SET domain containing (lysine methyltransferase) 7, SET7/9Histone H3-K4 methyltransferase SETD7, SET7Set9, SET9 |
|---|
| Gene, Accession # | SETD7, Gene ID: 80854, Accession: Q8WTS6, SwissProt: Q8WTS6 |
|---|
| Catalog # | NBP2-34101 |
|---|
| Price | |
|---|
| Order / More Info | SETD7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|