| Edit |   |
|---|
| Antigenic Specificity | SETD5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SETD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SETD5. This antibody reacts with rat. The SETD5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of Setd5. Immunizing peptide sequence ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT. |
|---|
| Other Names | DKFZp686J18276, FLJ10707, KIAA1757, SET domain containing 5, SET domain-containing protein 5 |
|---|
| Gene, Accession # | SETD5, Gene ID: 55209, Accession: D4A2W7 |
|---|
| Catalog # | NBP1-74109-20ul |
|---|
| Price | |
|---|
| Order / More Info | SETD5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|