| Edit |   |
| Antigenic Specificity | NSMCE4A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-NSMCE4A Antibody |
| Immunogen | The immunogen for Anti-NSMCE4A antibody is: synthetic peptide directed towards the C-terminal region of Human NSMCE4A. Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA |
| Other Names | C10orf86, NS4EA, NSE4A, non-SMC element 4 homolog A (S. cerevisiae) |
| Gene, Accession # | NSE4A, Accession: NM_001167865 |
| Catalog # | TA337472 |
| Price | |
| Order / More Info | NSMCE4A Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |