| Edit |   |
|---|
| Antigenic Specificity | TEAD2 |
|---|
| Clone | 2D5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TEAD2 Antibody (2D5) from Novus Biologicals is a mouse monoclonal antibody to TEAD2. This antibody reacts with human. The TEAD2 Antibody (2D5) has been validated for the following applications: ELISA. |
|---|
| Immunogen | TEAD2 (NP_003589 218 a.a. - 307 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLN |
|---|
| Other Names | TEA domain family member 2TEF4ETF, TEAD-2, TEF-4, transcriptional enhancer factor TEF-4 |
|---|
| Gene, Accession # | TEAD2, Gene ID: 8463, Accession: NP_003589, SwissProt: NP_003589 |
|---|
| Catalog # | H00008463-M01 |
|---|
| Price | |
|---|
| Order / More Info | TEAD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|