| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEIL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEIL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEIL2. This antibody reacts with human. The NEIL2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS |
|---|
| Other Names | DNA glycosylase/AP lyase Neil2, EC 3.2.2.-, EC 4.2.99.18, endonuclease 8-like 2, Endonuclease VIII-like 2, FLJ31644, MGC2832, MGC4505, NEH2DNA-(apurinic or apyrimidinic site) lyase Neil2, nei endonuclease VIII-like 2 (E. coli), Nei homolog 2, nei like 2, nei like 2 (E. coli), NEI2, Nei-like protein 2 |
|---|
| Gene, Accession # | NEIL2, Gene ID: 252969 |
|---|
| Catalog # | NBP2-68972 |
|---|
| Price | |
|---|
| Order / More Info | NEIL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|