| Edit |   |
|---|
| Antigenic Specificity | Prrx2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Prrx2 Antibody |
|---|
| Immunogen | The immunogen for Anti-Prrx2 Antibody is: synthetic peptide directed towards the middle region of Mouse Prrx2. Synthetic peptide located within the following region: AKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTMSPDYLSWPASS |
|---|
| Other Names | PMX2, PRX2, paired related homeobox 2 |
|---|
| Gene, Accession # | Prrx2, Accession: NM_009116 |
|---|
| Catalog # | TA332002 |
|---|
| Price | |
|---|
| Order / More Info | Prrx2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|