Edit |   |
Antigenic Specificity | CT47A12 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-CT47A12 Antibody |
Immunogen | The immunogen for Anti-CT47A12 antibody is: synthetic peptide directed towards the C-terminal region of Human CT47A12. Synthetic peptide located within the following region: PTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKG |
Other Names | CT47, CT47.12, cancer/testis antigen family 47, member A12 |
Gene, Accession # | CT47A12, Accession: NM_001242922 |
Catalog # | TA330860 |
Price | |
Order / More Info | CT47A12 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |