| Edit |   |
|---|
| Antigenic Specificity | CST9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CST9 Antibody |
|---|
| Immunogen | The immunogen for Anti-CST9 Antibody: synthetic peptide directed towards the middle region of human CST9. Synthetic peptide located within the following region: IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK |
|---|
| Other Names | CLM, CTES7A, cystatin 9 (testatin) |
|---|
| Gene, Accession # | CST9, Accession: NM_001008693 |
|---|
| Catalog # | TA336142 |
|---|
| Price | |
|---|
| Order / More Info | CST9 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|