| Edit |   |
| Antigenic Specificity | CSNK1G1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal anti-CSNK1G1 antibody |
| Immunogen | The immunogen for anti-CSNK1G1 antibody: synthetic peptide directed towards the middle region of mouse CSNK1G1. Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW |
| Other Names | CK1gamma1, casein kinase 1, gamma 1 |
| Gene, Accession # | CSNK1G1, Accession: NM_173185 |
| Catalog # | TA329604 |
| Price | |
| Order / More Info | CSNK1G1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |