Edit |   |
Antigenic Specificity | PRPSAP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, porcine, zebrafish |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-PRPSAP2 Antibody |
Immunogen | The immunogen for Anti-PRPSAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human PRPSAP2. Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ |
Other Names | PAP41, phosphoribosyl pyrophosphate synthetase-associated protein 2 |
Gene, Accession # | KPRB, Accession: NM_002767 |
Catalog # | TA342155 |
Price | |
Order / More Info | PRPSAP2 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |