| Edit |   |
| Antigenic Specificity | PRPSAP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog, human, mouse, porcine, zebrafish |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-PRPSAP2 Antibody |
| Immunogen | The immunogen for Anti-PRPSAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human PRPSAP2. Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ |
| Other Names | PAP41, phosphoribosyl pyrophosphate synthetase-associated protein 2 |
| Gene, Accession # | KPRB, Accession: NM_002767 |
| Catalog # | TA342155 |
| Price | |
| Order / More Info | PRPSAP2 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |