| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dopamine beta-Hydroxylase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dopamine beta-Hydroxylase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dopamine beta-Hydroxylase. This antibody reacts with human. The Dopamine beta-Hydroxylase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Dopamine beta-Hydroxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ |
|---|
| Other Names | DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1 |
|---|
| Gene, Accession # | DBH, Gene ID: 1621 |
|---|
| Catalog # | NBP2-57836 |
|---|
| Price | |
|---|
| Order / More Info | Dopamine beta-Hydroxylase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|