| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dopa Decarboxylase/DDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dopa Decarboxylase/DDC Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dopa Decarboxylase/DDC. This antibody reacts with human, mouse. The Dopa Decarboxylase/DDC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to DDC (dopa decarboxylase, aromatic L-amino acid decarboxylase). The peptide sequence was selected from the N terminal of DDC (NP_000781). Peptide sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE. |
|---|
| Other Names | AADCaromatic-L-amino-acid decarboxylase, DOPA decarboxylase, dopa decarboxylase (aromatic L-amino acid decarboxylase), EC 4.1.1, EC 4.1.1.28 |
|---|
| Gene, Accession # | DDC, Gene ID: 1644, Accession: P20711, SwissProt: P20711 |
|---|
| Catalog # | NBP1-56918 |
|---|
| Price | |
|---|
| Order / More Info | Dopa Decarboxylase/DDC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25343491, 29789702, 30364230 |
|---|
| 产品资料 |
|
|