| Edit |   |
|---|
| Antigenic Specificity | DOLPP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DOLPP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DOLPP1. This antibody reacts with human. The DOLPP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DOLPP1(dolichyl pyrophosphate phosphatase 1) The peptide sequence was selected from the N terminal of DOLPP1. Peptide sequence AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI. |
|---|
| Other Names | dolichyl pyrophosphate phosphatase 1LSFR2, dolichyldiphosphatase 1, EC 3.6.1, EC 3.6.1.43, linked to Surfeit genes in Fugu rubripes 2 |
|---|
| Gene, Accession # | DOLPP1, Gene ID: 57171, Accession: Q86YN1, SwissProt: Q86YN1 |
|---|
| Catalog # | NBP1-59981 |
|---|
| Price | |
|---|
| Order / More Info | DOLPP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|