| Edit |   |
|---|
| Antigenic Specificity | Bola2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-Bola2 antibody |
|---|
| Immunogen | The immunogen for anti-Bola2 antibody: synthetic peptide directed towards the n terminal of mouse Bola2. Synthetic peptide located within the following region: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL |
|---|
| Other Names | BOLA2A, My016, bolA family member 2 |
|---|
| Gene, Accession # | Bola2, Accession: NM_175103 |
|---|
| Catalog # | TA329608 |
|---|
| Price | |
|---|
| Order / More Info | Bola2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|