Edit |   |
Antigenic Specificity | Bola1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-Bola1 Antibody |
Immunogen | The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE |
Other Names | bolA family member 1 |
Gene, Accession # | Bola1, Accession: NM_026975 |
Catalog # | TA329941 |
Price | |
Order / More Info | Bola1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |