Edit |   |
Antigenic Specificity | ANKRD36B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ANKRD36B Antibody |
Immunogen | The immunogen for Anti-ANKRD36B antibody is: synthetic peptide directed towards the C-terminal region of Human ANKRD36B. Synthetic peptide located within the following region: LLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGD |
Other Names | KIAA1641, ankyrin repeat domain 36B |
Gene, Accession # | U634B, Accession: NM_025190 |
Catalog # | TA330708 |
Price | |
Order / More Info | ANKRD36B Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |