| Edit |   |
|---|
| Antigenic Specificity | ANKRD18A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ANKRD18A Antibody |
|---|
| Immunogen | The immunogen for anti-ANKRD18A antibody is: synthetic peptide directed towards the N-terminal region of Human ANKRD18A. Synthetic peptide located within the following region: VASEEKQERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYA |
|---|
| Other Names | ankyrin repeat domain 18A |
|---|
| Gene, Accession # | AN18A, Accession: NM_147195 |
|---|
| Catalog # | TA334825 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD18A Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|