| Edit |   |
| Antigenic Specificity | ANKRD7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rabbit, rat, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ANKRD7 Antibody |
| Immunogen | The immunogen for Anti-ANKRD7 Antibody: synthetic peptide directed towards the middle region of human ANKRD7. Synthetic peptide located within the following region: EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL |
| Other Names | TSA806, ankyrin repeat domain 7 |
| Gene, Accession # | ANKR7, Accession: NM_019644 |
| Catalog # | TA335504 |
| Price | |
| Order / More Info | ANKRD7 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |