| Edit |   |
|---|
| Antigenic Specificity | WDR3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-WDR3 Antibody |
|---|
| Immunogen | The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3. Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT |
|---|
| Other Names | DIP2, UTP12, WD repeat domain 3 |
|---|
| Gene, Accession # | WDR3, Accession: NM_006784 |
|---|
| Catalog # | TA330338 |
|---|
| Price | |
|---|
| Order / More Info | WDR3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|