| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DAP5 |
|---|
| Clone | 3B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DAP5 Antibody (3B5) from Novus Biologicals is a mouse monoclonal antibody to DAP5. This antibody reacts with human, rat. The DAP5 Antibody (3B5) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | EIF4G2 (NP_001409 811 a.a. - 889 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ |
|---|
| Other Names | aging-associated protein 1, DAP-5, DAP5AAG1, Death-associated protein 5, eIF4G 2, eIF-4G 2, eIF-4-gamma 2, eukaryotic translation initiation factor 4 gamma 2, eukaryotic translation initiation factor 4 gamma, 2, eukaryotic translation initiation factor 4G-like 1, FLJ41344, NAT1, p97 |
|---|
| Gene, Accession # | EIF4G2, Gene ID: 1982, Accession: NP_001409, SwissProt: NP_001409 |
|---|
| Catalog # | H00001982-M01 |
|---|
| Price | |
|---|
| Order / More Info | DAP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18400852, 25277244 |
|---|
| 产品资料 |
|
|