| Edit |   |
|---|
| Antigenic Specificity | B7-H7/HHLA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B7-H7/HHLA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B7-H7/HHLA2. This antibody reacts with human. The B7-H7/HHLA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human B7-H7/HHLA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL |
|---|
| Other Names | HERV-H LTR-associating 2, HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2 |
|---|
| Gene, Accession # | HHLA2, Gene ID: 11148 |
|---|
| Catalog # | NBP2-49187 |
|---|
| Price | |
|---|
| Order / More Info | B7-H7/HHLA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|