| Edit |   |
|---|
| Antigenic Specificity | NCAPH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-NCAPH2 Antibody |
|---|
| Immunogen | The immunogen for anti-NCAPH2 antibody: synthetic peptide directed towards the N terminal of human NCAPH2. Synthetic peptide located within the following region: SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE |
|---|
| Other Names | CAPH2, non-SMC condensin II complex, subunit H2 |
|---|
| Gene, Accession # | CNDH2, Accession: NM_014551 |
|---|
| Catalog # | TA329771 |
|---|
| Price | |
|---|
| Order / More Info | NCAPH2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|