| Edit |   |
|---|
| Antigenic Specificity | C7orf57 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat, horse, dog, guinea pig, bovine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-C7orf57 Antibody |
|---|
| Immunogen | The immunogen for Anti-C7orf57 Antibody is: synthetic peptide directed towards the C-terminal region of Human C7orf57. Synthetic peptide located within the following region: GQKNSSPTNFSKLISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRD |
|---|
| Other Names | chromosome 7 open reading frame 57 |
|---|
| Gene, Accession # | C7orf57, Accession: NM_001100159 |
|---|
| Catalog # | TA332204 |
|---|
| Price | |
|---|
| Order / More Info | C7orf57 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|