Edit |   |
Antigenic Specificity | C6orf163 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rabbit, horse, porcine, bovine, dog |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-C6orf163 Antibody |
Immunogen | The immunogen for anti-C6orf163 antibody is: synthetic peptide directed towards the C-terminal region of Human C6orf163. Synthetic peptide located within the following region: FLEEELQETRMAFQKYINYTFPKLSPGHADFILPERKKTPSNLVIKENKT |
Other Names | chromosome 6 open reading frame 163 |
Gene, Accession # | C6orf163, Accession: NM_001010868 |
Catalog # | TA334808 |
Price | |
Order / More Info | C6orf163 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |