Edit |   |
Antigenic Specificity | C5orf45 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-C5orf45 Antibody |
Immunogen | The immunogen for Anti-C5orf45 antibody is: synthetic peptide directed towards the N-terminal region of Human C5orf45. Synthetic peptide located within the following region: QGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLE |
Other Names | chromosome 5 open reading frame 45 |
Gene, Accession # | C5orf45, Accession: NM_016175 |
Catalog # | TA330650 |
Price | |
Order / More Info | C5orf45 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |