Edit |   |
Antigenic Specificity | C4orf51 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-C4orf51 Antibody |
Immunogen | The immunogen for Anti-C4orf51 Antibody is: synthetic peptide directed towards the C-terminal region of Human C4orf51. Synthetic peptide located within the following region: ITRPFKKSFDVKHGVAHQIWDFGDCFPTPPNYGKYCVRPKKPAQEALINY |
Other Names | chromosome 4 open reading frame 51 |
Gene, Accession # | C4orf51, Accession: NM_001080531 |
Catalog # | TA335924 |
Price | |
Order / More Info | C4orf51 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |