| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ITIH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ITIH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ITIH2. This antibody reacts with human, mouse. The ITIH2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human ITIH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET |
|---|
| Other Names | H2P, IGHEP2, inter-alpha (globulin) inhibitor H2, inter-alpha (globulin) inhibitor, H2 polypeptide, Inter-alpha-inhibitor heavy chain 2, Inter-alpha-trypsin inhibitor complex component II, inter-alpha-trypsin inhibitor heavy chain H2, ITI heavy chain H2, ITI-HC2, Serum-derived hyaluronan-associated protein, SHAP |
|---|
| Gene, Accession # | ITIH2, Gene ID: 3698, Accession: P19823, SwissProt: P19823 |
|---|
| Catalog # | NBP2-31750 |
|---|
| Price | |
|---|
| Order / More Info | ITIH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29855321 |
|---|
| 产品资料 |
|
|