| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ITGB1BP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ITGB1BP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ITGB1BP3. This antibody reacts with human. The ITGB1BP3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY. |
|---|
| Other Names | EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2 |
|---|
| Gene, Accession # | NMRK2, Gene ID: 27231, Accession: Q9NPI5, SwissProt: Q9NPI5 |
|---|
| Catalog # | NBP1-53033 |
|---|
| Price | |
|---|
| Order / More Info | ITGB1BP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|