| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ITIH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ITIH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ITIH1. This antibody reacts with human. The ITIH1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ITIH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPGDYFDLVLFGTRVQSWKGSLVQASEANLQAAQDFVRGFSLDEATNLNGGLLRGIEILNQVQESLPELSNHA |
|---|
| Other Names | H1P, IATIH, IGHEP1, inter-alpha (globulin) inhibitor H1, inter-alpha (globulin) inhibitor, H1 polypeptide, Inter-alpha-inhibitor heavy chain 1, Inter-alpha-trypsin inhibitor complex component III, inter-alpha-trypsin inhibitor heavy chain H1, ITI heavy chain H1, ITIH, ITI-HC1, MGC126415, Serum-derived hyaluronan-associated protein, SHAP |
|---|
| Gene, Accession # | ITIH1, Gene ID: 3697 |
|---|
| Catalog # | NBP1-81783 |
|---|
| Price | |
|---|
| Order / More Info | ITIH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|