Edit |   |
Antigenic Specificity | PPEF2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-PPEF2 Antibody |
Immunogen | The immunogen for anti-PPEF2 antibody is: synthetic peptide directed towards the C-terminal region of Human PPEF2. Synthetic peptide located within the following region: LVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKA |
Other Names | PPP7CB, protein phosphatase, EF-hand calcium binding domain 2 |
Gene, Accession # | PPE2, Accession: NM_006239 |
Catalog # | TA334351 |
Price | |
Order / More Info | PPEF2 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |