| Edit |   |
|---|
| Antigenic Specificity | Annexin 2 Receptor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Annexin 2 Receptor Antibody from Novus Biologicals is a rabbit polyclonal antibody to Annexin 2 Receptor. This antibody reacts with human. The Annexin 2 Receptor Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C5ORF39 The peptide sequence was selected from the N terminal of C5ORF39 (NP_001014301). Peptide sequence EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS. |
|---|
| Other Names | Annexin II receptor, annexin-2 receptor, AX2R, AXIIR, chromosome 5 open reading frame 39 |
|---|
| Gene, Accession # | ANXA2R, Gene ID: 389289, Accession: Q3ZCQ2, SwissProt: Q3ZCQ2 |
|---|
| Catalog # | NBP1-53077 |
|---|
| Price | |
|---|
| Order / More Info | Annexin 2 Receptor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|