| Edit |   |
|---|
| Antigenic Specificity | FOXD4L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine, rabbit, bovine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-FOXD4L1 Antibody |
|---|
| Immunogen | The immunogen for Anti-FOXD4L1 antibody is: synthetic peptide directed towards the N-terminal region of Human FOXD4L1. Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG |
|---|
| Other Names | FOXD5, bA395L14.1, forkhead box D4-like 1 |
|---|
| Gene, Accession # | FX4L1, Accession: NM_012184 |
|---|
| Catalog # | TA330872 |
|---|
| Price | |
|---|
| Order / More Info | FOXD4L1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|