| Edit |   |
|---|
| Antigenic Specificity | FAM70A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM70A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM70A. This antibody reacts with human. The FAM70A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FAM70A(family with sequence similarity 70, member A) The peptide sequence was selected from the N terminal of FAM70A. Peptide sequence IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR. |
|---|
| Other Names | family with sequence similarity 70, member A, FLJ20716, hypothetical protein LOC55026 |
|---|
| Gene, Accession # | TMEM255A, Gene ID: 55026, Accession: Q5JRV8, SwissProt: Q5JRV8 |
|---|
| Catalog # | NBP1-59972-20ul |
|---|
| Price | |
|---|
| Order / More Info | FAM70A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|