| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM62A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM62A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM62A. This antibody reacts with human. The FAM62A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FAM62A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF |
|---|
| Other Names | E-Syt1, extended synaptotagmin-like protein 1, family with sequence similarity 62 (C2 domain containing), member A, KIAA0747FAM62A, MBC2extended synaptotagmin-1, Membrane-bound C2 domain-containing protein |
|---|
| Gene, Accession # | ESYT1, Gene ID: 23344 |
|---|
| Catalog # | NBP2-57412 |
|---|
| Price | |
|---|
| Order / More Info | FAM62A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|