| 产品详情 |
| Edit |   |
| Antigenic Specificity | FAM59A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM59A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM59A. This antibody reacts with human. The FAM59A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FAM59A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILPMHFPLHLTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKGRCSGHNHVPNSLSYARDELTQS |
| Other Names | Chromosome 18 Open Reading Frame 11, chromosome 18 open reading frame 11, family with sequence, FAM59A, Family With Sequence Similarity 59, Member A, FLJ21610, GAREM, Gm944, GRB2 associated, regulator of MAPK1, Grb2-Associated And Regulator Of Erk/MAPK, GRB2-Associated And Regulator Of MAPK Protein, GRB2-Associated And Regulator Of MAPK1, Protein FAM59A |
| Gene, Accession # | GAREM, Gene ID: 64762 |
| Catalog # | NBP2-47460 |
| Price | |
| Order / More Info | FAM59A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|