| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM46A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM46A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM46A. This antibody reacts with human. The FAM46A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FAM46A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI |
|---|
| Other Names | C6orf37, chromosome 6 open reading frame 37, family with sequence similarity 46, member A, FLJ20037, FLJ31495, HBV XAg-transactivated protein 11, HBV X-transactivated gene 11 protein, hypothetical protein LOC55603, retinal expressed gene C6orf37, XTP11 |
|---|
| Gene, Accession # | FAM46A, Gene ID: 55603 |
|---|
| Catalog # | NBP2-49507 |
|---|
| Price | |
|---|
| Order / More Info | FAM46A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|