| 产品详情 |
| Edit |   |
| Antigenic Specificity | NLRP10/Pynod/NALP10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 26976200). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NLRP10/Pynod/NALP10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NLRP10/Pynod/NALP10. This antibody reacts with human. The NLRP10/Pynod/NALP10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NLRP10/Pynod/NALP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV |
| Other Names | CLR11.1, NACHT, leucine rich repeat and PYD containing 10, NALP10Pynod, NLR family, pyrin domain containing 10, NOD8Nucleotide-binding oligomerization domain protein 8, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 10, PAN5, PYNODNACHT, LRR and PYD domains-containing protein 10 |
| Gene, Accession # | NLRP10, Gene ID: 338322 |
| Catalog # | NBP1-85556 |
| Price | |
| Order / More Info | NLRP10/Pynod/NALP10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26976200 |
| 产品资料 |
|
|