| Edit |   |
|---|
| Antigenic Specificity | CEP70 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CEP70 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-CEP70 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP70. Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT |
|---|
| Other Names | BITE, centrosomal protein 70kDa |
|---|
| Gene, Accession # | CEP70, Accession: NM_024491 |
|---|
| Catalog # | TA344267 |
|---|
| Price | |
|---|
| Order / More Info | CEP70 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|