| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPIP137 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPIP137 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPIP137. This antibody reacts with human. The GPIP137 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPIP137 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM |
|---|
| Other Names | activation/proliferation-associated protein 1, caprin 1, caprin-1, cell cycle associated protein 1, Cell cycle-associated protein 1, Cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-associated protein-1, GPI-anchored membrane protein 1GPIP137, GPI-p137, M11S1GPI-anchored protein p137, Membrane component chromosome 11 surface marker 1, membrane component, chromosome 11, surface marker 1, p137GPI, RNA granule protein 105, RNG105GPIAP1 |
|---|
| Gene, Accession # | CAPRIN1, Gene ID: 4076 |
|---|
| Catalog # | NBP2-57388 |
|---|
| Price | |
|---|
| Order / More Info | GPIP137 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|